PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G2067
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 578aa    MW: 64874.2 Da    PI: 5.6195
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G2067genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix99.82.3e-3143129187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW++qe+laL+++r++m++ +r++ lk+plWeevs+k++e g++rs+k+Ckek+en+ k++k++k+g+ ++++++++t+++fd+lea
  Gh_A05G2067  43 RWPRQETLALLKIRSDMDSLFRDSTLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKYHKRTKDGRTSKADGKTKTYRFFDELEA 129
                  8************************************************************************************85 PP

2trihelix1041.1e-32379464187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+k ev aLi++r++++ +++++  k+plWee+s++mr  g++rs+k+Ckekwen+nk++kk+ke++k r +e+s+tcpyf+ql+a
  Gh_A05G2067 379 RWPKVEVEALIKLRTNLDIKYQDNGPKGPLWEEISAAMRNLGYNRSAKRCKEKWENINKYFKKVKENNKTR-PEDSKTCPYFHQLDA 464
                  8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00540102IPR001005SANT/Myb domain
PROSITE profilePS500906.91142100IPR017877Myb-like domain
CDDcd122031.08E-2542107No hitNo description
PfamPF138374.6E-2042129No hitNo description
SMARTSM007172.3E-4376438IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-4378435IPR009057Homeodomain-like
PROSITE profilePS500907.399378436IPR017877Myb-like domain
CDDcd122031.50E-26379443No hitNo description
PfamPF138371.2E-22379465No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MESSMVEGSA EAATTVAGIL EGSEGEEDRG RVDEGDRSFG GNRWPRQETL ALLKIRSDMD  60
SLFRDSTLKG PLWEEVSRKL AELGYHRSAK KCKEKFENVY KYHKRTKDGR TSKADGKTKT  120
YRFFDELEAF QNLHSLQPLS PPKPQTPTPT SASVMNPTNV PQSHATVPSI NPTLSTQPVP  180
PLHSINPCFI NISSNLFSTS TSSSTTSNDD SYQGSSGKKR KWKEFFRRLT KEVIEKQEEL  240
QNKFLQTIER CEQQRLAREE AWRVQEMARI NKEHELLVQE RSKAAAKDAA VFAFLQKVSG  300
QQPNTVQGNP QPQPQPPPPA QPMLAPLSTS LPPPPPPPVQ VPQPKTHPPP TQALNFDTSE  360
MSNGGNSAVS VSLSPSPSRW PKVEVEALIK LRTNLDIKYQ DNGPKGPLWE EISAAMRNLG  420
YNRSAKRCKE KWENINKYFK KVKENNKTRP EDSKTCPYFH QLDAIYKDKI SKNGNSLASS  480
SPYGVKPDSR ATVPLMVLPE QQWPPPRQAN NHQAETVVMM EEEADKGNVG HNNNHIQEEE  540
EEEEEEEEEE EEGDTEDEYE GNDFELVAKT APIGSGGE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.132500.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF4956784e-99JF495678.1 Gossypium herbaceum clone NBRI_M187 simple sequence repeat marker, genomic sequence.
GenBankJX9640914e-99JX964091.1 Gossypium hirsutum clone NBRI_TRANS-360 microsatellite sequence.
GenBankJX9644124e-99JX964412.1 Gossypium hirsutum clone NBRI_TRANS-681 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446164.10.0PREDICTED: trihelix transcription factor GT-2-like isoform X1
RefseqXP_012446165.10.0PREDICTED: trihelix transcription factor GT-2-like isoform X2
SwissprotQ391171e-143TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0B0MU260.0A0A0B0MU26_G
STRINGPOPTR_0002s06900.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48492553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-138Trihelix family protein